Monoclonal Anti-PARP1 antibody produced in mouse，100UG，WH0000142M1-100UG，Sigma

General description

Poly (ADP-ribose) polymerase 1 (PARP1) is a nuclear protein and belongs to the PARP family. This protein is made up of the N-terminal DNA-binding domain, central auto modification domain and C-terminal catalytic domain. PARP1 protein is located on the nucleoli. The PARP1 gene is located on the human chromosome at 1q42.12.

Immunogen

PARP1 (AAH37545, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQD

Application

Monoclonal Anti-PARP1 antibody produced in mouse has been used in:

• western blotting
• indirect immunofluorescence
• high-throughput cellular thermal shift assay (CESTA HT)

Biochem/physiol Actions

Poly (ADP-ribose) polymerase 1 (PARP1) protein plays a role in DNA repair by catalyzing the polymerization of adenosine diphosphate (ADP)-ribose units. This protein also plays a role in the early response to DNA damage. Mutations in the PARP1 gene is associated with loss of cell viability.

Features and Benefits

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.